metrics tools SEO Software

Die SEO Software metrics.tools ist erst seit August 2015 verfügbar, hat aber bereits einen festen Platz in meinen Lesezeichen. Die Testphase im Sommer war schon bezaubernd schnell und ausgereift. Im September 2015 startete das Programm dann mit einem radikalen Einführungspreis, dem nicht widerstanden werden konnte. Getestet, gekauft, bisher nicht bereut.

tl;dr – Fazit vorab

Der schnelle Blick in die Rankings, die Ausgabe der Top URLs der eigenen Seiten (und die der Marktteilnehmer), die fluffige und schnelle Keywordanalyse möchte ich nicht mehr missen. Zu einem Preis von unter 50 Euro im Monat auf jeden Fall einen Test wert.

Das Tool ist rattenschnell. Dank der Geschwindigkeit kann ich bereits beim ersten Telefonat mit einem potenziellen Kunden sehen, welche seiner Unterseiten gut und zu welchen Suchbegriffen gefunden werden. In Kombination mit dem Focus Tool von OnPage.org für die schnelle Erstanalyse ein SEO Träumchen 🙂

Einfach kostenlos und unverbindlich für 14 Tage testen.
Es ist keine Abmeldung erforderlich. -> https://metrics.tools

metrics.tools Eigenschaften

Sichtbarkeitsindex

Das Tool crawlt wöchentlich – mit Ergebnissen am Freitag – lt. Angaben von APImetrics eine Million Keywords, um zu einer gewünschten Domain die relevanten Rankings zu erheben. Daraus wird – ähnlich wie Sistrix, Searchmetrics, XOVI und Co. – eine Sichtbarkeitskennzahl ermittelt.

Welche konkreten Keywords für Veränderungen der Sichtbarkeitskennzahl sorgen, zeigt das Tool direkt in der Grafik zur Kurve an.

Monatlich werden weitere Keywords erfasst und stehen als Daten für SEO Analysen zur Verfügung. Auch exotische Begriffe für Nischen werden dadurch inkl. Historie erfasst.

muppet-show-suchvolumen

muppet-show-suchvolumen

Veränderungen

Im Menüpunkt Veränderungen werden zur gewünschten Domain Daten zu den Keywords aufgezeigt.
Verbesserungen und Verschlechterungen an Positionen werden tabellarisch aufgeschlüsselt.

rankings-veraenderungen

rankings-veraenderungen

Keyword Historie

Der historische Verlauf eines Keywords zu einer Domain wird hier erfasst. Das Datenmaterial startet im März 2015.

Top-Urls der Domain

Die sichtbarkeitsstärksten URLs einer ausgewählten Domain werden ausgewertet. Spannendes Feature! Ich sehe, welche Unterseiten im tooleigenen Sichtbarkeitsindex wichtig sind. Die Daten können nicht mit den Daten der Google Search Console mithalten, stehen dafür aber nicht nur für die eigenen Seiten, sondern für jede Domain zur Verfügung. Knickknack.
Welche Unterseite der Konkurrenz hat wohl den meisten Traffic? kann hier beantwortet werden.

Keywordrecherche

Die Keywordrecherche ist immer der Ausgangspunkt für ein neues Projekt. Anhand der Auswertung sehe ich, welche Suchbegriffe relevant sind. Schieberegler zur Relevanz, Suchvolumen und Wettbewerb zum Suchbegriff erleichtern die Sortierung.

keywordrecherche-metrics-tools

keywordrecherche-metrics-tools

 

Die metrics.tools

Vorteile

  • URL eingeben und sofort die Topseiten einer Seite sehen (die vom Tool so erkannt werden). Im Vergleich mit meinen Seiten, die ich direkt überwachen kann, sind die Daten plausibel.
  • Andreas Müller und das Team von Apimetrics arbeiten nach dem Motto: „Deploy early and often“. <3.
    Neue Funktionen und Ideen von Usern werden schnell beantwortet und wenn möglich umgesetzt.
  • Das Tool kommt von einem Techniker und ohne das übliche Vertriebsblabla aus.

Nachteile

  • Nix für SEO Anfänger oder Schnellundhektischreichwerdenreklametypen, die mit den Begriffen SERP, indexierte Seiten, Rankings evtl. nichts anfangen können.
    Obacht: Es gibt keine Hilfeboxen, hüpfende Büroklammern, rote Ampeln oder dergleichen 🙂

Screens vom Tool

Rankingverlauf mit Ansicht von Keywords

rankings-keywords-verlauf metrics.tools Demo

rankings-keywords-verlauf metrics.tools Demo

metrics.tools-keywordrecherche

metrics.tools-keywordrecherche

rankingveraenderungen metrics tools

rankingveraenderungen metrics tools

Tarife und Preisübersicht

Professional, 44,95 € pro Monat (zzgl. MwSt.)

Features:

  • Domainanalyse mit voller Historie
  • Keywordrankings auf Domain-, Host-, und URL Ebene, vollständige Historie
  • Hinweis auf geänderte Ranking-URLs zur Vorwoche
  • Anzeige der relevantesten Rankingveränderungen direkt im Chart für die volle Historie
  • Chart der SEO Keyword Top100 – Verteilung für die volle Historie
  • Vollständige Liste der Rankingveränderungen
  • Liste der Top-URLs von Domains, inkl. Chart für die volle Historie
  • 50.000 API+Export Credits (jeden Monat aufgefüllt)

Einfach kostenlos und unverbindlich für 14 Tage testen.
Es ist keine Abmeldung erforderlich. -> https://metrics.tools

Professional Plus, 89,95 € pro Monat (zzgl. MwSt.)

  • Domain-, Host- und URL Sichtbarkeits-Chart mit voller Historie
  • Keyword Rankings auf Domain-, Host-, und URL Ebene, vollständige Historie
  • Hinweis auf geänderte Ranking-URLs zur Vorwoche
  • Anzeige der relevantesten Rankingveränderungen direkt im Chart für die volle Historie
  • Chart der SEO Keyword Top100 – Verteilung für die volle Historie
  • Vollständige Liste der Rankingveränderungen
  • Liste der Top-URLs von Domains, inkl. Chart für die volle Historie
  • Semantische Keywordrecherche
  • 75.000 API+Export Credits (jeden Monat aufgefüllt)
  • 1000 individuelle Keywords im wöchentlichen Monitoring

 

Enterprise, 199,95 € pro Monat (zzgl. MwSt.)

  • Domain-, Host- und URL Sichtbarkeits-Chart mit voller Historie
  • Keyword Rankings auf Domain-, Host- und URL Ebene, vollständige Historie
  • Hinweis auf geänderte Ranking-URLs zur Vorwoche
  • Anzeige der relevantesten Rankingveränderungen direkt im Chart für die volle Historie
  • Chart der SEO Keyword Top100 – Verteilung für die volle Historie
  • Vollständige Liste der Rankingveränderungen
  • Liste der Top-URLs von Domains, inkl. Chart für die volle Historie
  • Semantische Keywordrecherche
  • 750.000 API+Export Credits (jeden Monat aufgefüllt)
  • Option auf Erwerb zusätzlicher API+Export Credits

Einfach kostenlos und unverbindlich für 14 Tage testen.
Es ist keine Abmeldung erforderlich. -> https://metrics.tools

Weitere Testberichte